PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g12417.1.p
Common NameBRADI_5g12417, LOC100822603
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 342aa    MW: 36753.9 Da    PI: 7.0641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g12417.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++q G g+W++ +++ g+ R++k+c++rw +yl
  Bradi5g12417.1.p 14 KGPWTPEEDQKLLAYIEQQGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding53.17.2e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Bradi5g12417.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.126961IPR017930Myb domain
SuperFamilySSF466892.92E-2911108IPR009057Homeodomain-like
SMARTSM007173.8E-131363IPR001005SANT/Myb domain
PfamPF002494.3E-151461IPR001005SANT/Myb domain
CDDcd001673.56E-101661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.8E-1667112IPR001005SANT/Myb domain
CDDcd001673.35E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLAYIE QQGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DASGAGGAGT GDGAGAQHAK AAAHLSHTAQ WESARLEAEA RLAREAKLRA  180
LAASASSASA HQQQQHYLNA APAPGLDSPT STLSFSSDSA AAVALASAVL EAAAARAAMQ  240
PMQQAYEDAC KEQQQHWGDH HVDAAGFPGS GFTGMLLDGS LNQNPRAGDD DARDQADVVV  300
EVHDTEEEKN YWNSILSLVN SSASSVVVPA GHEAYSPAPE F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3603780.0AK360378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1116O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579906.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1IYH80.0I1IYH8_BRADI; Uncharacterized protein
STRINGBRADI5G12417.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-86myb domain protein 16